Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

991 – 1,005 of 1,558,848 results

991

Invitrogen™ S6 Monoclonal Antibody (C.896.4)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat,Monkey,Drosophila
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P29327, P62753, P62754, P62755
Isotype	IgG1
Concentration	5 μg/mL
Antigen	S6
Gene Symbols	RPS6
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	(Rp)S6; 40S ribosomal protein S6; air[8]; air8; anon-WO02059370.61; CG10944; CG10944-PA; CG10944-PB; Dmel\CG10944; Dmel_CG10944; DS6; hemocytes enlarged; hen; l(1)air[8]; l(1)air8; l(1)hen; LD31286p; lethal(1)aberrant immune response[8]; lethal-(1)-haemocytes enlarged; lethal-aberrant-immune-response-8; M(1)7BC; M(1)7C; minute; minute (1) 7BC; OK/SW-cl.2; OTTHUMP00000021121; OTTHUMP00000021122; Phosphoprotein NP33; pp30; ribosomal protein S6; Rp S6; RP11-513M16.6; RPS6; RpS6-PA; RpS6-PB; RS6; S6; S6 ribosomal protein; S6R; Small ribosomal subunit protein eS6; wu:fa92e06; wu:fb64g06; zgc:92237
Gene	RPS6
Product Type	Antibody
Gene ID (Entrez)	20104, 29304, 31700, 6194
Formulation	0.01M HEPES with 100μg/mL BSA, 50% glycerol, 0.15M NaCl and <0.02% sodium azide; pH 7.5
Immunogen	Recombinant fusion protein corresponding to full-length human S6 ribosomal protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	C.896.4

992

Invitrogen™ p23 Monoclonal Antibody (JJ3)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat,Rabbit,Chicken,Guinea Pig
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,RNA Immunoprecipitation,Immunocytochemistry
Form	Liquid
Gene Accession No.	G1TGF1, P83868, Q15185, Q90955, Q9R0Q7
Isotype	IgG1
Concentration	Conc. Not Determined
Antigen	p23
Gene Symbols	LOC100351480, Ptges3
Regulatory Status	RUO
Gene Alias	5730442A20Rik; Co chaperone p23; cPGES; cytosolic prostaglandin E synthase; cytosolic prostaglandin E2 synthase; Hsp90 co chaperone; Hsp90 co-chaperone; LOC100351480; P23; p23 cochaperone; progesterone receptor; progesterone receptor complex p23; Prostaglandin E synthase 3; prostaglandin E synthase 3 (cytosolic); prostaglandin-E synthase 3; Ptges; PTGES3; ptges3 {ECO:0000250; RGD1561913; sid 3177; Sid3177; Tebp; telomerase binding protein, p23; telomerase-binding protein p23; unactive progesterone receptor, 23 kD; UniProtKB:Q15185}
Gene	Ptges3
Product Type	Antibody
Gene ID (Entrez)	100345490, 100351480, 100718334, 100859133, 10728, 362809, 56351
Formulation	ascites with 0.05% sodium azide
Immunogen	Recombinant human p23 protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	JJ3

993

NLRC4 Polyclonal Antibody

Pricing & Availability

994

Invitrogen™ VEGFC Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Bovine,Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	O35757, P49767, P97953
Isotype	IgG
Concentration	0.3 mg/mL
Antigen	VEGFC
Gene Symbols	VEGFC
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AW228853; Flt4 ligand; FLT4 ligand DHM; Flt4-L; LMPH1D; Vascular endothelial growth factor C; vascular endothelial growth factor C isoform 129; vascular endothelial growth factor C isoform 184; vascular endothelial growth factor-related protein; VEGF3; VEGFC; VEGF-C; VRP
Gene	VEGFC
Product Type	Antibody
Gene ID (Entrez)	114111, 22341, 282122, 7424
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human VEGFC. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

995

Invitrogen™ HK2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Horse,Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	A2PYL6, O08528, P27881, P52789
Isotype	IgG
Concentration	0.63 mg/mL
Antigen	HK2
Gene Symbols	Hk2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI642394; DKFZp686M1669; Hexokinase; hexokinase 2; hexokinase II; hexokinase type II; Hexokinase-2; hexokinase-2 muscle; hexokinase-2, muscle; Hexokinase-B; HK II; Hk2; HKII; HXK2; muscle form hexokinase; OTTHUMP00000202738
Gene	Hk2
Product Type	Antibody
Gene ID (Entrez)	100009677, 15277, 25059, 3099
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human Hexokinase II. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

996

Invitrogen™ IDO Monoclonal Antibody (V1NC3IDO), Alexa Fluor™ Plus 647

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor Plus 647
Applications	Immunohistochemistry (Paraffin),Multiplex Immunohistochemistry
Form	Liquid
Gene Accession No.	P14902
Isotype	IgG2b κ
Concentration	0.2 mg/mL
Antigen	IDO
Gene Symbols	Ido1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	EC 1.13.11.52; IDO; IDO1; IDO-1; INDO; indolamine 2,3 dioxygenase; indole 2,3-dioxygenase; indoleamine; indoleamine 2,3-dioxygenase 1; indoleamine 23-dioxygenase; Indoleamine-2; indoleamine-pyrrole 2,3 dioxygenase; indoleamine-pyrrole 2,3-dioxygenase
Gene	Ido1
Product Type	Antibody
Gene ID (Entrez)	3620
Formulation	PBS with 0.5% BSA, 10% proprietary stabilizer and 0.05% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	V1NC3IDO

997

Invitrogen™ Ataxin 7 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Drosophila
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O15265
Isotype	IgG
Concentration	1 mg/mL
Antigen	Ataxin 7
Gene Symbols	ATXN7
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	A430107N12Rik; ADCAII; AI627028; Ataxin 7; Ataxin7; Ataxin-7; ATXN7; Atxn7-PA; Atxn7-PB; Atxn7-PC; Atxn7-PD; CG9866; CG9866-PA; CG9866-PB; CG9866-PC; CG9866-PD; Dmel\CG9866; Dmel_CG9866; LD40170p; OPCA3; RGD1562692; SCA7; spinocerebellar ataxia 7 homolog; spinocerebellar ataxia type 7 protein; Spinocerebellar ataxia type 7 protein homolog
Gene	ATXN7
Product Type	Antibody
Gene ID (Entrez)	33423, 6314
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic Peptide: M(1) S E R A A D D V R G E P R R A A(17) C.
Classification	Polyclonal
Primary or Secondary	Primary

998

Invitrogen™ TGF beta-1,2,3 Recombinant Rat Monoclonal Antibody (eBioTB2F)

Rat Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rat
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry
Form	Liquid
Gene Accession No.	P01137, P10600, P61812
Isotype	IgG2a κ
Concentration	1 mg/mL
Antigen	TGF beta-1,2,3
Gene Symbols	TGFB1, TGFB2, TGFB3
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CED; DPD1; LAP; Latency-associated peptide; prepro-transforming growth factor beta-1; regulatory protein; tgf beta 1; tgf beta 3; tgf beta1; TGFB; Tgfb1; Tgfb-1; TGFB4; TGFbeta; TGF-beta 1; TGFbeta1; TGF-beta1; TGF-beta-1; TGF-beta4; tissue growth factor-beta4; Transforming growth factor; transforming growth factor beta 1; transforming growth factor beta 4; transforming growth factor beta 4 precursor; transforming growth factor beta-1; Transforming growth factor beta-1 proprotein; transforming growth factor beta-1 proprotein; transforming growth factor beta-1; transforming growth factor, beta 1; transforming growth factor, beta 1 (Camurati-Engelmann disease); transforming growth factor, beta-1; transforming growth factor-beta 1; transforming growth factor-beta-1 precursor
Gene	TGFB1
Product Type	Antibody
Gene ID (Entrez)	7040, 7042, 7043
Formulation	PBS with 0.09% sodium azide; pH 7.4
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	eBioTB2F

999

Invitrogen™ TFF1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P04155, Q08423
Isotype	IgG
Concentration	0.17 mg/mL
Antigen	TFF1
Gene Symbols	TFF1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Bcei; breast cancer estrogen-inducible protein; breast cancer estrogen-inducible sequence; D21S21; gastrointestinal trefoil protein pS2; HP1.A; HPS2; PNR-2; polypeptide P1.A; Protein pS2; PS2; TFF1; Trefoil factor 1
Gene	TFF1
Product Type	Antibody
Gene ID (Entrez)	21784, 7031
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Full length human TFF1 Recombinant protein.
Classification	Polyclonal
Primary or Secondary	Primary

1,000

Invitrogen™ CD11c Monoclonal Antibody (N418), Brilliant Violet™ 605, eBioscience™

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Armenian Hamster
Conjugate	Brilliant Violet 605
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q9QXH4
Isotype	IgG
Concentration	0.2 mg/mL
Antigen	CD11c
Gene Symbols	Itgax
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin, alpha X (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6
Gene	Itgax
Product Type	Antibody
Gene ID (Entrez)	16411
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	N418

1,001

Invitrogen™ CD71 (Transferrin Receptor) Monoclonal Antibody (OKT9 (OKT-9)), Brilliant Ultra Violet™ 615, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Ultraviolet 615
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P02786
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD71 (Transferrin Receptor)
Gene Symbols	TFRC
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	2610028K12Rik; AI195355; AI426448; AU015758; CD antigen CD71; CD71; chicken transferrin receptor; E430033M20Rik; I79_000642; IMD46; mammary tumor virus receptor 1; Mtvr1; Mtvr-1; p90; sTfR; T9; TfR; tfR1; TFR2; TFRC; TR; transferrin receptor; transferrin receptor (p90, CD71); transferrin receptor 2; transferrin receptor protein 1; Transferrin receptor protein 1, serum form; Trfr
Gene	TFRC
Product Type	Antibody
Gene ID (Entrez)	7037
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	OKT9 (OKT-9)

1,002

Invitrogen™ O-linked N-acetylglucosamine (O-GlcNAc) Monoclonal Antibody (RL2)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Chemical
Host Species	Mouse
Conjugate	Unconjugated
Applications	ChIP Assay,Dot Blot,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form	Liquid
Gene Accession No.	O15294, Q8CGY8, P56558
Isotype	IgG1
Concentration	2 mg/mL
Antigen	O-linked N-acetylglucosamine (O-GlcNAc)
Gene Symbols	OGT
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	GlcNAc; HINCUT-1; HRNT1; O-GLCNAC; O-GlcNAc transferase p110 subunit; O-GlcNAc transferase subunit p110; OGT; O-linked N-acetylglucosamine (GlcNAc) transferase; O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase); O-linked N-acetylglucosamine transferase 110 kDa subunit; UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase; UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit; uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyl transferase
Gene	OGT
Product Type	Antibody
Gene ID (Entrez)	108155, 26295, 8473
Formulation	PBS with 0.05% sodium azide
Immunogen	Pore complex-lamina fraction purified from rat liver nuclear envelopes.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RL2

1,003

Invitrogen™ CD56 Monoclonal Antibody (56C04)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P13591, P13596
Isotype	IgG1 κ
Concentration	0.2 mg/mL
Antigen	CD56
Gene Symbols	Ncam1
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	adhesion molecule; antigen recognized by monoclonal antibody 5.1H11; Cd56; CD-56; CD56 120 kDa GPI-linked isoform; CD56 140 kDa isoform; CD56 140 kDa VASE isoform; E NCAM; E-NCAM; MSK39; N CAM1; NCAM; N-CAM; Ncam1; N-CAM-1; NCAM-1; NCAMC; NCAM-C; neural cell adhesion molecule; Neural cell adhesion molecule 1; neural cell adhesion molecule, NCAM; sCD56; sNCAM; soluble CD56; soluble NCAM
Gene	Ncam1
Product Type	Antibody
Gene ID (Entrez)	24586, 4684
Formulation	PBS with 0.05% BSA and 0.05% sodium azide; pH 7.4
Immunogen	Membrane preparation of a small cell lung carcinoma.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	56C04

1,004

Invitrogen™ SLC34A2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O95436, Q9DBP0, Q9JJ09
Isotype	IgG
Concentration	500 μg/mL
Antigen	SLC34A2
Gene Symbols	SLC34A2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AA536683; D5Ertd227e; Na(+)/Pi cotransporter 2B; Na(+)-dependent phosphate cotransporter 2B; NAPI IIb; NaPi-2b; NaPi3b; NAPI-3B; NAPI-IIb; Npt2b; NPTIIb; rNaPi IIb; Slc34a2; Sodium/phosphate cotransporter 2B; Sodium-dependent phosphate transport protein 2B; sodium-phosphate transport protein 2B; solute carrier family 34 (sodium phosphate), member 2; solute carrier family 34 (type II sodium/phosphate contransporter), member 2; solute carrier family 34 (type II sodium/phosphate cotransporter), member 2; solute carrier family 34 member 2; type II sodium-dependent phosphate transporter 3b; type IIb Na/Picotransporter; type IIb sodium-phosphate transporter
Gene	SLC34A2
Product Type	Antibody
Gene ID (Entrez)	10568, 20531, 84395
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).
Classification	Polyclonal
Primary or Secondary	Primary

1,005

Invitrogen™ CD11a Monoclonal Antibody (TS1/22)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P20701, P24063
Isotype	IgG1
Concentration	0.4 mg/mL
Antigen	CD11a
Gene Symbols	ITGAL
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	(p180); alpha L integrin; antigen CD11A (p180); antigen CD11A (p180), lymphocyte function-associated antigen 1, alpha polypeptide; antigen CD11A p180; CD11 antigen-like family member A; CD11a; integrin alpha L; integrin alphaL; integrin alpha-L; integrin alpha-L precursor; integrin gene promoter; integrin subunit alpha L; integrin surface receptor; integrin, alpha L; integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide); ITGAL; Leukocyte adhesion glycoprotein LFA-1 alpha chain; leukocyte function-associated molecule 1 alpha chain; LFA-1; LFA-1 alpha; LFA1A; LFA-1A; Ly-15; Ly-21; lymphocyte antigen 15; lymphocyte function associated antigen 1, alpha polypeptide; lymphocyte function-associated antigen 1; lymphocyte function-associated antigen 1, alpha polypeptide; lymphocyte function-associated antigen-1
Gene	ITGAL
Product Type	Antibody
Gene ID (Entrez)	16408, 3683
Formulation	PBS with no preservative
Immunogen	Human 180 kD alpha chain of the CD11alpha complex.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TS1/22

Prev
1
...
65
66
67
68
...
103,924
Next

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ S6 Monoclonal Antibody (C.896.4) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ p23 Monoclonal Antibody (JJ3) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

NLRC4 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VEGFC Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HK2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Ataxin 7 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TFF1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD11c Monoclonal Antibody (N418), Brilliant Violet™ 605, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ O-linked N-acetylglucosamine (O-GlcNAc) Monoclonal Antibody (RL2) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD56 Monoclonal Antibody (56C04) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SLC34A2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD11a Monoclonal Antibody (TS1/22) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ S6 Monoclonal Antibody (C.896.4)

Invitrogen™ p23 Monoclonal Antibody (JJ3)

NLRC4 Polyclonal Antibody

Invitrogen™ VEGFC Polyclonal Antibody

Invitrogen™ HK2 Polyclonal Antibody

Invitrogen™ Ataxin 7 Polyclonal Antibody

Invitrogen™ TFF1 Polyclonal Antibody

Invitrogen™ CD11c Monoclonal Antibody (N418), Brilliant Violet™ 605, eBioscience™

Invitrogen™ O-linked N-acetylglucosamine (O-GlcNAc) Monoclonal Antibody (RL2)

Invitrogen™ CD56 Monoclonal Antibody (56C04)

Invitrogen™ SLC34A2 Polyclonal Antibody

Invitrogen™ CD11a Monoclonal Antibody (TS1/22)